PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00187.1.g00450.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 712aa    MW: 77103.5 Da    PI: 7.9296
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00187.1.g00450.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.72.6e-1515541756
                                  HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  +lF+++++p+ ++r++L+++l+L+ rqVk+WFqNrR+  k
  Zpz_sc00187.1.g00450.1.sm.mk 15 RLFKESPHPDDKQRQQLSRQLRLSARQVKFWFQNRRTHIK 54
                                  68**********************************9766 PP

2START180.41e-561804082206
                                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCCG CS
                         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddk 69 
                                   la +a++el ++ +a+ep+Wv+s+    + +n+de+l+ f++++           s+ea+ra+gvv  ++++lv  ++d++
  Zpz_sc00187.1.g00450.1.sm.mk 180 LAGRALEELTTMCSAGEPLWVRSVetsrDVLNYDEYLRLFPRGDDgpgggrrapWSVEASRATGVVYLDTTRLVHAFMDVS 260
                                   67899**********************9*************99889*********************************** PP

                                   GCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.. CS
                         START  70 eqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe. 138
                                    qW+e ++    ka+tl vi+ g      ga+qlm+ae q+l+p+vp R+f f+Ry+++l a++w++vdvS d  ++  + 
  Zpz_sc00187.1.g00450.1.sm.mk 261 -QWKELFPsmisKASTLSVIQAGenddqdGAIQLMSAEVQMLTPVVPtREFRFLRYCKKLAAEKWAVVDVSFDKAEPDAQt 340
                                   .*******9999***************************************************************999998 PP

                                   -TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 139 sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                   ss   ++ + pSg+++e+  ngh+kvtwveh+ ++ +++++++r    sgla+ga++wva+lq qce+
  Zpz_sc00187.1.g00450.1.sm.mk 341 SSTACKCLKNPSGCVVEERTNGHCKVTWVEHTTCRNATVTSMYRAAAASGLAFGARRWVAALQVQCER 408
                                   99999*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003896.3E-6760IPR001356Homeobox domain
CDDcd000861.74E-121554No hitNo description
SuperFamilySSF466895.43E-121557IPR009057Homeodomain-like
PfamPF000469.1E-131554IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-131559IPR009057Homeodomain-like
PROSITE profilePS5007114.2521756IPR001356Homeobox domain
PROSITE patternPS0002703154IPR017970Homeobox, conserved site
CDDcd146860.009333681No hitNo description
PROSITE profilePS5084838.374170411IPR002913START domain
SuperFamilySSF559619.42E-28173408No hitNo description
CDDcd088754.28E-94174407No hitNo description
SMARTSM002341.1E-49179408IPR002913START domain
PfamPF018524.3E-46180408IPR002913START domain
Gene3DG3DSA:3.30.530.208.1E-6236392IPR023393START-like domain
SuperFamilySSF559611.1E-10427579No hitNo description
SuperFamilySSF559611.1E-10628662No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MTLLADAFMV DSTGRLFKES PHPDDKQRQQ LSRQLRLSAR QVKFWFQNRR THIKERQENA  60
LLKSELEKLQ EENRAMRELV RKPSHCPGCG VPFSGNTTAA TTSEEHLLRL ENARLKAETW  120
NTVQVERLRG TPGTTPPVGA VALPASPSCR AVQSNSPSSL DDYYVDGFLA GHDKARILDL  180
AGRALEELTT MCSAGEPLWV RSVETSRDVL NYDEYLRLFP RGDDGPGGGR RAPWSVEASR  240
ATGVVYLDTT RLVHAFMDVS QWKELFPSMI SKASTLSVIQ AGENDDQDGA IQLMSAEVQM  300
LTPVVPTREF RFLRYCKKLA AEKWAVVDVS FDKAEPDAQT SSTACKCLKN PSGCVVEERT  360
NGHCKVTWVE HTTCRNATVT SMYRAAAASG LAFGARRWVA ALQVQCERMV FSVATNIPTR  420
DSNGVRTPAG RRSVLKLAHR MTSSLCRGIG ASRGVAWSRA PNGGGRGDVL VMSRRNTGDP  480
GEPQGLIACA VLSTWLPVSP TALLDFLRDE SRRHEWEATL LGRSVHSCAN VTKGKDRGNC  540
VTIYVTFTPS RAITTLHLSQ KEPSIVVTDS TCLLPSLPHQ AANSSAAEDK TGAGNWIVQD  600
SSTGPCESVV AYAPVDAAIL RRVIDGHDPS DVALLPCGFA ITPDGLDSRP AVITSSVDLD  660
GSAAKGALVT VAFQAMATPT DGVMPPDSVA AATGLVVSTL GNIKKALRCE DC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701492.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLK3XSK50.0K3XSK5_SETIT; Uncharacterized protein
STRINGSi004904m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein